TOMM22, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant TOMM22.

Brand:  Abnova PAB28636.100uL

Product Code. 16126910

Description

The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq

Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK

Specifications

• Antigen: TOMM22
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant TOMM22.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: 1C9-2/MST065/MSTP065/TOM22
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 56993
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Gene: TOMM22
• Gene Symbols: TOMM22
• Immunogen: Recombinant protein corresponding to amino acids of human TOMM22.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

For Research Use Only