STAP2 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant STAP2.

Brand:  Abnova PAB20118.100uL

Product Code. 16193240

Description

This gene encodes the substrate of breast tumor kinase, an Src-type nonreceptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: NYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAPCTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSS

Specifications

• Antigen: STAP2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant STAP2.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: BKS/FLJ20234
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 55620
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Western Blot, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:10-1:20) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: STAP2
• Gene Symbols: STAP2
• Immunogen: Recombinant protein corresponding to amino acids of human STAP2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only