SLC6A15, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SLC6A15.

Brand:  Abnova PAB20440.100uL

Product Code. 16143520

Description

SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites (Farmer et al., 2000 [PubMed 11112352]).[supplied by OMIM

Sequence: RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ

Specifications

• Antigen: SLC6A15
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant SLC6A15.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: DKFZp761I0921/FLJ10316/MGC87066/NTT73/SBAT1/V7-3/hv7-3
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 55117
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: SLC6A15
• Gene Symbols: SLC6A15
• Immunogen: Recombinant protein corresponding to amino acids of human SLC6A15.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only