SLC22A8 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SLC22A8.

Brand:  Abnova PAB28282.100uL

Product Code. 16176660

Description

The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. [provided by RefSeq

Sequence: KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR

Specifications

• Antigen: SLC22A8
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant SLC22A8.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: MGC24086/OAT3
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 9376
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Formalin/Paraffin)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:2500-1:5000) The optimal working dilution should be determined by the end user.
• Gene: SLC22A8
• Gene Symbols: SLC22A8
• Immunogen: Recombinant protein corresponding to amino acids of recombinant SLC22A8.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only