missing translation for 'onlineSavingsMsg'
Learn More

Sept8, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against partial recombinant Sept8.

Brand: Abnova PAB15710.50ug

Product Code. 16071707

£535.00 / 50µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

Sequence: AVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRIHQEEKRKVEEKRRELEEETNAFNCRKAAMEALQSQALHATSQQPLRKDKDKKN

Specifikationer

Antigen	Sept8.
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against partial recombinant Sept8.
Formulation	In PBS (50% glycerol, 0.02% sodium azide)
Gene Alias	AW046166/Sepl/mKIAA0202
Host Species	Rabbit
Quantity	50 μg
Primary or Secondary	Primary
Test Specificity	Specific to recombinant protein GX0010. This antibody detects endogenous mSEPT8 protein in several cell types. It also recognizes human SEPT8 protein.
Content And Storage	Store at -20°C. Aliquot to avoid repeated freezing and thawing.

Applications	Immunohistochemistry (Frozen), Immunohistochemistry (PFA fixed), Western Blot
Conjugate	Unconjugated
Dilution	Western Blot (1:1000) The optimal working dilution should be determined by the end user.
Gene	Sept8
Gene Symbols	Sept8
Immunogen	Recombinant GST fusion protein corresponding to 192 mouse Sept8.
Regulatory Status	RUO
Gene ID (Entrez)	20362
Target Species	Mouse
Form	Liquid

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Cancel Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

Sept8, Rabbit, Polyclonal Antibody, Abnova™

Beskrivning

Specifikationer

Produktförslag

Dokument

Kampanjer