SCRT1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SCRT1.

Brand:  Abnova PAB24402.100uL

Product Code. 16024777

Description

This gene is a member of the Snail family of C2H2-type zinc finger transcription factors. It codes for a neural-specific transcriptional repressor that binds to E-box motifs. The protein may promote neural differention and may be involved in cancers with neuroendocrine features. [provided by RefSeq

Sequence: LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP

Specifications

• Antigen: SCRT1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant SCRT1.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: DKFZp547F072/SCRT
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 83482
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Gene: SCRT1
• Gene Symbols: SCRT1
• Immunogen: Recombinant protein corresponding to amino acids of human SCRT1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only