SCARF2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant SCARF2.

Brand:  Abnova PAB22849.100uL

Product Code. 16135490

Description

The protein encoded by this gene is similar to SCARF1/SREC-I, a scavenger receptor protein that mediates the binding and degradation of acetylated low density lipoprotein (Ac-LDL). This protein has only little activity of internalizing modified low density lipoproteins (LDL), but it can interact with SCARF1 through its extracellular domain. The association of this protein with SCARF1 is suppressed by the presence of scavenger ligands. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: HHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVP

Specifications

• Antigen: SCARF2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant SCARF2.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: NSR1/SREC-II/SREC2/SRECRP-1
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 91179
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: SCARF2
• Gene Symbols: SCARF2
• Immunogen: Recombinant protein corresponding to amino acids of human SCARF2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only