RPGRIP1L, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant RPGRIP1L.

Brand:  Abnova PAB23540.100uL

Product Code. 16136050

Description

The protein encoded by this gene can localize to the basal body-centrosome complex or to primary cilia and centrosomes in ciliated cells. The encoded protein has been found to interact with nephrocystin-4. Defects in this gene are a cause of Joubert syndrome type 7 (JBTS7) and Meckel syndrome type 5 (MKS5). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: KNTITLEVHQAYSTEYETIAACQLKFHEILEKSGRIFCTASLIGTKGDIPNFGTVEYWFRLRVPMDQAIRLYRERAKALGYITSNFKGPEHMQSLSQQAPKTAQLSSTDSTDGNL

Specifications

• Antigen: RPGRIP1L
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant RPGRIP1L.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: CORS3/DKFZp686C0668/JBTS7/KIAA1005/MKS5/NPHP8
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 23322
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: RPGRIP1L
• Gene Symbols: RPGRIP1L
• Immunogen: Recombinant protein corresponding to amino acids of human RPGRIP1L.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only