RNASEL, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant RNASEL.

Brand:  Abnova PAB28675.100uL

Product Code. 16176940

Description

This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele. [provided by RefSeq

Sequence: HGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSI

Specifications

• Antigen: RNASEL
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant RNASEL.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene Alias: DKFZp781D08126/MGC104972/MGC133329/PRCA1/RNS4
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 6041
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry Western Blot The optimal working dilution should be determined by the end user.
• Gene: RNASEL
• Gene Symbols: RNASEL
• Immunogen: Recombinant protein corresponding to amino acids of human RNASEL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only