RBM15B, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant RBM15B.

Brand:  Abnova PAB23043.100uL

Product Code. 16135640

Description

Members of the SPEN (Split-end) family of proteins, including RBM15B, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM

Sequence: GKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSG

Specifications

• Antigen: RBM15B
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant RBM15B.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: HUMAGCGB/OTT3
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 29890
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:500-1:1000) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: RBM15B
• Gene Symbols: RBM15B
• Immunogen: Recombinant protein corresponding to amino acids of human RBM15B.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only