RAB3GAP2 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant RAB3GAP2.

Brand:  Abnova PAB21889.100uL

Product Code. 16134710

Description

Members of the RAB3 protein family (see RAB3A; MIM 179490) are implicated in Ca(2+)-dependent exocytosis. RAB3GAP, which is involved in regulation of RAB3 activity, is a heterodimeric complex consisting a 130kDa catalytic subunit (RAB3GAP1; MIM 602536) and a 150kDa noncatalytic subunit (RAB3GAP2) (Nagano et al., 1998 [PubMed 9733780]).[supplied by OMIM

Sequence: EHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPT

Specifications

• Antigen: RAB3GAP2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant RAB3GAP2.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: DKFZp434D245/FLJ14579/KIAA0839/RAB3-GAP150/RAB3GAP150/p150
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 25782
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
• Gene: RAB3GAP2
• Gene Symbols: RAB3GAP2
• Immunogen: Recombinant protein corresponding to amino acids of human RAB3GAP2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only