PSMD14, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant PSMD14.

Brand:  Abnova PAB28572.100uL

Product Code. 16126850

Description

PSMD14 is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).[supplied by OMIM

Sequence: AVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDA

Specifications

• Antigen: PSMD14
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant PSMD14.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: PAD1/POH1/rpn11
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 10213
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Western Blot (Human: 1:100-1:250, Mouse/Rat: 1:100-1:500) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Gene: PSMD14
• Gene Symbols: PSMD14
• Immunogen: Recombinant protein corresponding to human PSMD14.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

For Research Use Only