PQBP1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant PQBP1.

Brand:  Abnova PAB28529.100uL

Product Code. 16176810

Description

PQBP1 is a nuclear polyglutamine-binding protein that contains a WW domain (Waragai et al., 1999 [PubMed 10332029]).[supplied by OMIM

Sequence: PVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVD

Specifications

• Antigen: PQBP1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant PQBP1.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: MRX55/MRXS3/MRXS8/NPW38/RENS1/SHS
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 10084
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunofluorescence (1-4 ug/ml) Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: PQBP1
• Gene Symbols: PQBP1
• Immunogen: Recombinant protein corresponding to amino acids of human PQBP1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only