PPP2R3A Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant PPP2R3A.

Brand:  Abnova PAB22913.100uL

Product Code. 16195530

Description

Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B″/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B″ family. The B″ family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B″. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE

Specifications

• Antigen: PPP2R3A
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant PPP2R3A.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: PPP2R3/PR130/PR72
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 5523
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: PPP2R3A
• Gene Symbols: PPP2R3A
• Immunogen: Recombinant protein corresponding to amino acids of human PPP2R3A.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only