POLDIP3, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant POLDIP3.

Brand:  Abnova PAB21164.100uL

Product Code. 16144100

Description

This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified. [provided by RefSeq

Sequence: SLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAR

Specifications

• Antigen: POLDIP3
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant POLDIP3.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: KIAA1649/PDIP46/SKAR
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 84271
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: POLDIP3
• Gene Symbols: POLDIP3
• Immunogen: Recombinant protein corresponding to amino acids of human POLDIP3.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only