PDGFA Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against PDGFA.

Brand:  Abnova PAB16158.100ug

Product Code. 16031857

Description

The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer or as a heterodimer with the platelet-derived growth factor beta polypeptide, where the dimers are connected by disulfide bonds. Studies using knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth. Two splice variants have been identified for this gene. [provided by RefSeq

Sequence: VKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVR

Specifications

• Antigen: PDGFA
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against PDGFA.
• Formulation: In TBS, pH 7.4 (50% glycerol, 1% BSA, 0.03% Proclin).
• Gene Alias: PDGF-A/PDGF1
• Host Species: Rabbit
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

• Applications: ELISA, Immunohistochemistry, Western Blot
• Conjugate: Unconjugated
• Dilution: ELISA (1-2 ug/mL) Western Blot (2-10 ug/mL) Immunohistochemistry (2-10 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: PDGFA
• Gene Symbols: PDGFA
• Immunogen: Human PDGFA.
• Regulatory Status: RUO
• Gene ID (Entrez): 5154
• Content And Storage: Store at 4°C for 1 month. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only