PCTK1 Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant PCTK1.

Brand:  Abnova PAB28420.100uL

Product Code. 16196730

Description

The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells. This gene is thought to escape X inactivation. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD

Specifications

• Antigen: PCTK1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant PCTK1.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: FLJ16665/PCTAIRE/PCTAIRE1/PCTGAIRE
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 5127
• Content And Storage: Store at 4 °C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Western Blot (1:100-1:250) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: PCTK1
• Gene Symbols: PCTK1
• Immunogen: Recombinant protein corresponding to human PCTK1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

For Research Use Only