P11, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant P11.

Brand:  Abnova PAB20598.100uL

Product Code. 16193650

Description

This gene encodes a protein with protease activity. Its specific function has not been determined. The protein may be useful as a tumor marker. [provided by RefSeq

Sequence: CCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRY

Specifications

• Antigen: P11
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant P11.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: MGC133268/PP11/PRSS26
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 8909
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: P11
• Gene Symbols: P11
• Immunogen: Recombinant protein corresponding to amino acids of human P11.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only