OGDH Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant OGDH.

Brand:  Abnova PAB21263.100uL

Product Code. 16154180

Description

This gene encodes one subunit of the 2-oxoglutarate dehydrogenase complex. This complex catalyzes the overall conversion of 2-oxoglutarate (alpha-ketoglutarate) to succinyl-CoA and CO(2) during the Krebs cycle. The protein is located in the mitochondrial matrix and uses thiamine pyrophosphate as a cofactor. A congenital deficiency in 2-oxoglutarate dehydrogenase activity is believed to lead to hypotonia, metabolic acidosis, and hyperlactatemia. Alternative splicing results in multiple transcript variants encoding distinct isoforms

Sequence: FRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQ

Specifications

• Antigen: OGDH
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant OGDH.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: AKGDH/E1k/OGDC
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 4967
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: OGDH
• Gene Symbols: OGDH
• Immunogen: Recombinant protein corresponding to amino acids of human OGDH.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only