NRXN3, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant NRXN3.

Brand:  Abnova PAB20129.100uL

Product Code. 16193250

Description

Neurexins are a family of proteins that function in the vertebrate nervous system as cell adhesion molecules and receptors. They are encoded by several unlinked genes of which two, NRXN1 and NRXN3, are among the largest known human genes. Three of the genes (NRXN1-3) utilize two alternate promoters and include numerous alternatively spliced exons to generate thousands of distinct mRNA transcripts and protein isoforms. The majority of transcripts are produced from the upstream promoter and encode alpha-neurexin isoforms; a much smaller number of transcripts are produced from the downstream promoter and encode beta-neurexin isoforms. The alpha-neurexins contain epidermal growth factor-like (EGF-like) sequences and laminin G domains, and have been shown to interact with neurexophilins. The beta-neurexins lack EGF-like sequences and contain fewer laminin G domains than alpha-neurexins. [provided by RefSeq

Sequence: LTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVECEPSTANPTEP

Specifications

• Antigen: NRXN3
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant NRXN3.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: KIAA0743/MGC176711
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 9369
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: NRXN3
• Gene Symbols: NRXN3
• Immunogen: Recombinant protein corresponding to amino acids of human NRXN3.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only