NME1-NME2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant NME1-NME2.

Brand:  Abnova PAB27463.100uL

Product Code. 16196380

Description

The NME1-NME2 mRNA is a naturally occurring co-transcribed product of the neighboring NME1 and NME2 genes. The significance of this co-transcribed mRNA and the function of its predicted protein product have not yet been determined. Alternative splicing of this gene results in different transcript variants encoding distinct isoforms, but the full-length nature of each variant has not been defined. [provided by RefSeq

Sequence: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ

Specifications

• Antigen: NME1-NME2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant NME1-NME2.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: NME2
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 654364
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) Immunofluorescence (1-4 ug/mL) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
• Gene: NME1-NME2
• Gene Symbols: NME1-NME2
• Immunogen: Recombinant protein corresponding to amino acids of human NME1-NME2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only