NLGN4X, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant NLGN4X

Brand:  Abnova PAB28472.100uL

Product Code. 16186780

Description

This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq

Sequence: QYPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGS

Specifications

• Antigen: NLGN4X
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant NLGN4X
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: ASPGX2/AUTSX2/HLNX/HNLX/KIAA1260/MGC22376/NLGN/NLGN4
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 57502
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry(1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: NLGN4X
• Gene Symbols: NLGN4X
• Immunogen: Recombinant protein corresponding to amino acids of human NLGN4X
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only