NIPA1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant NIPA1.

Brand:  Abnova PAB21503.100uL

Product Code. 16194380

Description

This gene encodes a magnesium transporter that associates with early endosomes and the cell surface in a variety of neuronal and epithelial cells. This protein may play a role in nervous system development and maintenance. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene have been associated with autosomal dominant spastic paraplegia 6. [provided by RefSeq

Sequence: HGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRA

Specifications

• Antigen: NIPA1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant NIPA1.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: FSP3/MGC102724/MGC35570/SPG6
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 123606
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
• Gene: NIPA1
• Gene Symbols: NIPA1
• Immunogen: Recombinant protein corresponding to amino acids of human NIPA1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only