NCAPH, subunit H, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant NCAPH, subunit H.

Brand:  Abnova PAB28677.100uL

Product Code. 16196940

Description

This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization. [provided by RefSeq

Sequence: LHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMTDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNESVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSLGDDFDANDEPDHT

Specifications

• Antigen: NCAPH, subunit H
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant NCAPH, subunit H.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
• Gene Alias: BRRN1/CAP-H/HCAP-H
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 23397
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Western Blot, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:100-1:500) The optimal working dilution should be determined by the end user.
• Gene: NCAPH
• Gene Symbols: NCAPH
• Immunogen: Recombinant protein corresponding to amino acids of human NCAPH.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

For Research Use Only