MPDU1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant MPDU1.

Brand:  Abnova PAB20774.100uL

Product Code. 16143790

Description

This gene encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-P-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type If. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK

Specifications

• Antigen: MPDU1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant MPDU1.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: CDGIF/FLJ14836/HBEBP2BPA/Lec35/My008/PP3958/PQLC5/SL15
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 9526
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: MPDU1
• Gene Symbols: MPDU1
• Immunogen: Recombinant protein corresponding to amino acids of human MPDU1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Liquid

For Research Use Only