MED12 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant MED12.

Brand:  Abnova PAB28711.100uL

Product Code. 16196970

Description

The initiation of transcription is controlled in part by a large protein assembly known as the preinitiation complex. A component of this preinitiation complex is a 1.2mDa protein aggregate called Mediator. This Mediator component binds with a CDK8 subcomplex which contains the protein encoded by this gene, mediator complex subunit 12 (MED12), along with MED13, CDK8 kinase, and cyclin C. The CDK8 subcomplex modulates Mediator-polymerase II interactions and thereby regulates transcription initiation and reinitation rates. The MED12 protein is essential for activating CDK8 kinase. Defects in this gene cause X-linked Opitz-Kaveggia syndrome, also known as FG syndrome, and Lujan-Fryns syndrome. [provided by RefSeq

Sequence: LPTTMTGVMGLEPSSYKTSVYRQQQPAVPQGQRLRQQLQAKIQSQGMLGQSSVHQMTPSSSYGLQTSQGYTPYVSHVGLQQHTGPAGTMVPPSYSSQPYQSTHPSTNPTLVDPTRHLQQRPSGYVHQQAPTYGHGLTS

Specifications

• Antigen: MED12
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant MED12.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: CAGH45/FGS1/HOPA/KIAA0192/OKS/OPA1/TNRC11/TRAP230
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 9968
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Gene: MED12
• Gene Symbols: MED12
• Immunogen: Recombinant protein corresponding to amino acids of human MED12.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only