MAGEE1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant MAGEE1.

Brand:  Abnova PAB28639.100uL

Product Code. 16156910

Description

Sequence: STLFSSSASVDRNPSKCSLVLPSPRVTKASVDSDSEGPKGAEGPIEFEVLRDCESPNSISIMGLNTSRVAITLKPQDPMEQNVAELLQFLLVKDQSKYPIRE

Specifications

• Antigen: MAGEE1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant MAGEE1.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: DAMAGE/HCA1/KIAA1587
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 57692
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Formalin/Paraffin)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Gene: MAGEE1
• Gene Symbols: MAGEE1
• Immunogen: Recombinant protein corresponding to amino acids of human MAGEE1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only