KIF4A Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant KIF4A.

Brand:  Abnova PAB22822.100uL

Product Code. 16195460

Description

Kinesins, such as KIF4A, are microtubule-based motor proteins that generate directional movement along microtubules. They are involved in many crucial cellular processes, including cell division (Zhu and Jiang, 2005 [PubMed 15625105]).[supplied by OMIM

Sequence: SDETVACMAAAIDTAVEQEAQVETSPETSRSSDAFTTQHALRQAQMSKELVELNKALALKEALARKMTQNDSQLQPIQYQYQDN

Specifications

• Antigen: KIF4A
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant KIF4A.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: FLJ12530/FLJ12655/FLJ14204/FLJ20631/HSA271784/KIF4/KIF4-G1
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 24137
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: KIF4A
• Gene Symbols: KIF4A
• Immunogen: Recombinant protein corresponding to amino acids of human KIF4A.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only