KCNK17, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant KCNK17.

Brand:  Abnova PAB24275.100uL

Product Code. 16024667

Description

The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is activated at alkaline pH. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: CSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS

Specifications

• Antigen: KCNK17
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant KCNK17.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: K2p17.1/TALK-2/TALK2/TASK-4/TASK4
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 89822
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: KCNK17
• Gene Symbols: KCNK17
• Immunogen: Recombinant protein corresponding to amino acids of human KCNK17.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only