KCNJ12, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant KCNJ12.

Brand:  Abnova PAB27489.100uL

Product Code. 16126410

Description

This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq]

Sequence: RCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI

Specifications

• Antigen: KCNJ12
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant KCNJ12.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Alias: FLJ14167/IRK2/KCNJN1/Kir2.2/Kir2.2v/hIRK/hIRK1/hkir2.2x/kcnj12x
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 3768
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: KCNJ12
• Gene Symbols: KCNJ12
• Immunogen: Recombinant protein corresponding to amino acids of human KCNJ12.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only