KANSL1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant KANSL1.

Brand:  Abnova PAB20355.100uL

Product Code. 16183440

Description

Sequence: APLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSARKDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHDPNHSKMRLRDHSS

Specifications

• Antigen: KANSL1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant KANSL1.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: CENP-36/KDVS/KIAA1267/MSL1v1/NSL1/hMSL1v1
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 284058
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: KANSL1
• Gene Symbols: KANSL1
• Immunogen: Recombinant protein corresponding to amino acids of human KANSL1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

Safety and Handling

Product Identifier

• 100UL KANSL1 polyclonal antibody

Signal Word

• Warning

Hazard Category

• Acute toxicity Category 4
• Serious eye damage/eye irritation Category 2
• Skin corrosion/irritation Category 2

Hazard Statement

• H302-Harmful if swallowed.
• H315-Causes skin irritation.
• H318-Causes serious eye damage.

Precautionary Statement

• P102-Keep out of reach of children.
• P103-Read label before use.
• P210-Keep away from heat, hot surfaces, sparks, open flames and other ignition sources. No smoking.
• P233-Keep container tightly closed.
• P241-Use explosion-proof electrical/ventilating/lighting/ equipment.
• P264-Wash hands thoroughly after handling.
• P280-Wear protective gloves/protective clothing/eye protection/face protection.
• P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
• P303+P361+P353-IF ON SKIN (or hair): Take off immediately all contaminated clothing. Rinse skin with water/ shower.
• P304+P340-IF INHALED: Remove person to fresh air and keep comfortable for breathing.
• P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
• P370+P378-In case of fire: Use to extinguish.
• P405-Store locked up.
• P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.

Supplemental information

• MIXTURE LIST-Contains : sodium phosphate monobasic, potasssium phosphate dibasic

For Research Use Only