IRF4 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant IRF4.

Brand:  Abnova PAB28541.100uL

Product Code. 16186820

Description

Sequence: SNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPE

Specifications

• Antigen: IRF4
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant IRF4.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: LSIRF/MUM1
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 3662
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Western Blot (1:- 1:) Immunofluorescence (1-4 ug/ml) Immunohistochemistry (1:-1:) The optimal working dilution should be determined by the end user.
• Gene: IRF4
• Gene Symbols: IRF4
• Immunogen: Recombinant protein corresponding to amino acids of human IRF4.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only