HVCN1 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant HVCN1.

Brand:  Abnova PAB23414.100uL

Product Code. 16195940

Description

HVCN1 is a voltage-gated proton channel highly expressed in immune tissues. Channels like HVCN1 mediate the proton conductances required by phagocytic leukocytes for the oxidative burst that underlies microbial killing (Ramsey et al., 2006 [PubMed 16554753]).[supplied by OMIM

Sequence: GIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN

Specifications

• Antigen: HVCN1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant HVCN1.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: HV1/MGC15619/VSOP
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 84329
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Gene: HVCN1
• Gene Symbols: HVCN1
• Immunogen: Recombinant protein corresponding to amino acids of human HVCN1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only