HSPA12B Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant HSPA12B.

Brand:  Abnova PAB20831.100uL

Product Code. 16183830

Description

The protein encoded by this gene contains an atypical heat shock protein 70 (Hsp70) ATPase domain and is therefore a distant member of the mammalian Hsp70 family. This gene may be involved in susceptibility to atherosclerosis. [provided by RefSeq

Sequence: LAVPEMGLQGLYIGSSPERSPVPSPPGSPRTQESCGIAPLTPSQSPKPEVRAPQQASFSVVVAIDFGTTSSGYAFSFASDPEAIHMMRKWEGG

Specifications

• Antigen: HSPA12B
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant HSPA12B.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: C20orf60/FLJ32150/MGC131912/dJ1009E24.2
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 116835
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user.
• Gene: HSPA12B
• Gene Symbols: HSPA12B
• Immunogen: Recombinant protein corresponding to amino acids of human HSPA12B.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only