HNF1B, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant HNF1B.

Brand:  Abnova PAB28567.100uL

Product Code. 16186840

Description

This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene

Sequence: KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH

Specifications

• Antigen: HNF1B
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant HNF1B.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: FJHN/HNF1beta/HNF2/HPC11/LF-B3/LFB3/MODY5/TCF2/VHNF1
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 6928
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Dilution: Western Blot (1:250-1:500) Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Gene: HNF1B
• Gene Symbols: HNF1B
• Immunogen: Recombinant protein corresponding to human HNF1B.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only