GTPBP10, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant GTPBP10.

Brand:  Abnova PAB21354.100uL

Product Code. 16134260

Description

Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM

Sequence: ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF

Specifications

• Antigen: GTPBP10
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant GTPBP10.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: A4D1E9
• Gene Symbols: GTPBP10
• Immunogen: Recombinant protein corresponding to amino acids of human GTPBP10.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: GTPBP10
• Gene Alias: DKFZp686A10121/FLJ38242/MGC104191/ObgH2/UG0751c10
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 85865
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only