GOLIM4 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant GOLIM4

Brand:  Abnova PAB28477.100uL

Product Code. 16126790

Description

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. [provided by RefSeq

Sequence: EHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAED

Specifications

• Antigen: GOLIM4
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant GOLIM4
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: F8W785
• Gene Symbols: GOLIM4
• Immunogen: Recombinant protein corresponding to amino acids of human GOLIM4
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry(1:200-1:500) Immunofluorescence(1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Gene: GOLIM4
• Gene Alias: GIMPC/GOLPH4/GPP130/P138
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 27333
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only