FAR1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant FAR1.

Brand:  Abnova PAB20937.100uL

Artikelnummer. 16193910

Beschreibung

Sequence: YYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNENLRDAVQLNVIATRQLILLAQQMKNLEVFM

Spezifikation

• Antigen: FAR1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant FAR1.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q8WVX9
• Gene Symbols: FAR1
• Immunogen: Recombinant protein corresponding to amino acids of human FAR1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:10-1:20) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: FAR1
• Gene Alias: DKFZp686A0370/DKFZp686P18247/FLJ22728/FLJ33561/MLSTD2/SDR10E1
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 84188
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only