EXOC6, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant EXOC6.

Brand:  Abnova PAB22976.100uL

Product Code. 16115590

Description

The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: TFSVSLQKQNKMKFGKNMYINRDRIPEERNETVLKHSLEEE

Specifications

• Antigen: EXOC6
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant EXOC6.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q8TAG9
• Gene Symbols: EXOC6
• Immunogen: Recombinant protein corresponding to amino acids of human EXOC6.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: EXOC6
• Gene Alias: DKFZp761I2124/EXOC6A/FLJ1125/FLJ11251/MGC33397/SEC15/SEC15L/SEC15L1/SEC15L3/Sec15p
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 54536
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only