ECE1, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ECE1.

Brand:  Abnova PAB28442.100uL

Product Code. 16186750

Description

Endothelin-converting enzyme-1 is involved in the proteolytic processing of endothelin-1 (EDN1; MIM 131240), -2 (EDN2; MIM 131241), and -3 (EDN3; MIM 131242) to biologically active peptides.[supplied by OMIM

Sequence: IMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKR

Specifications

• Antigen: ECE1
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant ECE1.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: B4DKB2
• Gene Symbols: ECE1
• Immunogen: Recombinant protein corresponding to amino acids of recombinant ECE1.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry(1:20-1:50) The optimal working dilution should be determined by the end user.
• Gene: ECE1
• Gene Alias: ECE
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 1889
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only