DUS2L Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DUS2L.

Brand:  Abnova PAB28129.100uL

Product Code. 16136580

Description

Dihydrouridine synthase catalyzes reduction of the 5,6-double bond of a uridine residue on the displacement loop of tRNA. The resultant modified base, 5,6-dihydrouridine, appears to increase the conformational flexibility and dynamic motion of tRNA (Kato et al., 2005 [PubMed 15994936]).[supplied by OMIM

Sequence: RLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKILSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVIKAIADTLSIP

Specifications

• Antigen: DUS2L
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant DUS2L.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q9NX74
• Gene Symbols: DUS2L
• Immunogen: Recombinant protein corresponding to amino acids of recombinant DUS2L.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: DUS2L
• Gene Alias: DUS2/FLJ20399/SMM1/URLC8
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 54920
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only