DNAJC25-GNG10, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DNAJC25-GNG10.

Brand:  Abnova PAB27473.100uL

Product Code. 16186390

Description

This gene represents naturally-occurring mRNAs that are co-transcribed products of the neighboring DNAJC25 and GNG10 genes. These transcripts include the first exon of DNAJC25 and the last two exons of GNG10, resulting in a protein that combines the N-terminus of DNAJC25 and the C-terminus of GNG10. [provided by RefSeq

Sequence: NIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD

Specifications

• Antigen: DNAJC25-GNG10
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant DNAJC25-GNG10.
• Formulation: In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
• Gene Symbols: DNAJC25-GNG10
• Immunogen: Recombinant protein corresponding to amino acids of human DNAJC25-GNG10.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Gene: DNAJC25-GNG10
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 552891
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only