DNAAF2 Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DNAAF2.

Brand:  Abnova PAB20263.100uL

Product Code. 16163370

Description

The KTU gene encodes a protein conserved in animals and ciliated unicellular organisms involved in preassembly of dynein arm complexes in species from algae to humans (Omran et al., 2008 [PubMed 19052621]).[supplied by OMIM

Sequence: GEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLE

Specifications

• Antigen: DNAAF2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant DNAAF2.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q9NVR5
• Gene Symbols: DNAAF2
• Immunogen: Recombinant protein corresponding to amino acids of human DNAAF2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: DNAAF2
• Gene Alias: C14orf104/CILD10/KTU/PF13
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 55172
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only