DLG2, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DLG2.

Brand:  Abnova PAB21384.100uL

Product Code. 16104290

Description

This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. The encoded protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described, but their full-length nature is not known. [provided by RefSeq

Sequence: KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP

Specifications

• Antigen: DLG2
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant DLG2.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q15700
• Gene Symbols: DLG2
• Immunogen: Recombinant protein corresponding to amino acids of human DLG2.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: DLG2
• Gene Alias: DKFZp781D1854/DKFZp781E0954/FLJ37266/MGC131811/PSD-93/PSD93/chapsyn-110
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 1740
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only