DDX24, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant DDX24.

Brand:  Abnova PAB28588.100uL

Product Code. 16186860

Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which shows little similarity to any of the other known human DEAD box proteins, but shows a high similarity to mouse Ddx24 at the amino acid level. [provided by RefSeq

Sequence: FPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKE

Specifications

• Antigen: DDX24
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant DDX24.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: F5GYL3
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 57062
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunofluorescence (1-4 ug/ml) Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
• Gene: DDX24
• Gene Symbols: DDX24
• Immunogen: Recombinant protein corresponding to amino acids of human DDX24.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only