missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DCLRE1A, Rabbit, Polyclonal Antibody, Abnova™
Description
DNA interstrand cross-links prevent strand separation, thereby physically blocking transcription, replication, and segregation of DNA. DCLRE1A is one of several evolutionarily conserved genes involved in repair of interstrand cross-links (Dronkert et al., 2000 [PubMed 10848582]).[supplied by OMIM
Sequence: TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG
Specifications
Specifications
| Antigen | DCLRE1A |
| Applications | Immunofluorescence, Immunohistochemistry (PFA fixed) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Description | Rabbit polyclonal antibody raised against recombinant DCLRE1A. |
| Dilution | Immunohistochemistry (1:20-1:50) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user. |
| Formulation | In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide) |
| Gene | DCLRE1A |
| Gene Accession No. | Q6PJP8 |
| Gene Alias | KIAA0086/PSO2/SNM1/SNM1A/hSNM1 |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?