CREM, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant CREM

Brand:  Abnova PAB28489.100uL

Product Code. 16136800

Description

This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq

Sequence: QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD

Specifications

• Antigen: CREM
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant CREM
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: E9PBM5
• Gene Symbols: CREM
• Immunogen: Recombinant protein corresponding to amino acids of human CREM
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry(1:500-1:1000) Western Blot(1:250-1:500) Immunofluorescence(1-4 ug/ml) The optimal working dilution should be determined by the end user.
• Gene: CREM
• Gene Alias: ICER/MGC111110/MGC17881/MGC41893/hCREM-2
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 1390
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only