COPG, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant COPG.

Brand:  Abnova PAB23180.100uL

Artikelnummer. 16195750

Beschreibung

Sequence: VKQPEKVAATRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTE

Spezifikation

• Antigen: COPG
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant COPG.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q9Y678
• Gene Symbols: COPG
• Immunogen: Recombinant protein corresponding to amino acids of human COPG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

• Applications: Immunohistochemistry, Western Blot, Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: COPG
• Gene Alias: COPG1/FLJ21068
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 22820
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only