CNPY3, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant CNPY3.

Brand:  Abnova PAB20883.100uL

Product Code. 16173870

Description

PRAT4A is associated with the immature form of TLR4 (MIM 603030) and regulates its cell surface expression (Wakabayashi et al., 2006 [PubMed 16849487]).[supplied by OMIM

Sequence: GVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSIRAKAAGGRSSSSKQRKEL

Specifications

• Antigen: CNPY3
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant CNPY3.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: Q9BT09
• Gene Symbols: CNPY3
• Immunogen: Recombinant protein corresponding to amino acids of human CNPY3.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
• Gene: CNPY3
• Gene Alias: CAG4A/ERDA5/PRAT4A/TNRC5
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 10695
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only