CACNA1H, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant CACNA1H.

Brand:  Abnova PAB23513.100uL

Product Code. 16196020

Description

This gene encodes a T-type member of the alpha-1 subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. The alpha-1 subunit has 24 transmembrane segments and forms the pore through which ions pass into the cell. There are multiple isoforms of each of the proteins in the complex, either encoded by different genes or the result of alternative splicing of transcripts. Alternate transcriptional splice variants, encoding different isoforms, have been characterized for the gene described here. Studies suggest certain mutations in this gene lead to childhood absence epilepsy (CAE). [provided by RefSeq

Sequence: EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP

Specifications

• Antigen: CACNA1H
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant CACNA1H.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Accession No.: O95180
• Gene Symbols: CACNA1H
• Immunogen: Recombinant protein corresponding to amino acids of human CACNA1H.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: Immunohistochemistry (PFA fixed)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
• Gene: CACNA1H
• Gene Alias: CACNA1HB/Cav3.2/EIG6/FLJ90484
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 8912
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

For Research Use Only